PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G103900.1.p
Common NameSb09g016570, SORBIDRAFT_09g016570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 358aa    MW: 37053.4 Da    PI: 5.96
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G103900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.34.8e-203277147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          +g+WT+eEd+ll +av+++G+++W+ I+++++ gR++k+c++rw + 
  Sobic.009G103900.1.p 32 KGSWTPEEDDLLRRAVTRHGPRNWTVISAEIP-GRSGKSCRLRWCNQ 77
                          799*****************************.***********985 PP

2Myb_DNA-binding57.72.8e-1884128147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           r ++T+eEd  +v a++q+G++ W+tIar++  gRt++++k++w++ 
  Sobic.009G103900.1.p  84 RRAFTPEEDAVIVAAHAQYGNK-WATIARMLH-GRTDNSVKNHWNST 128
                           678*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.7182782IPR017930Myb domain
SuperFamilySSF466894.23E-3030125IPR009057Homeodomain-like
SMARTSM007171.1E-163180IPR001005SANT/Myb domain
PfamPF002492.8E-193277IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-243385IPR009057Homeodomain-like
CDDcd001678.00E-163476No hitNo description
SMARTSM007176.0E-1583131IPR001005SANT/Myb domain
PfamPF002491.1E-1484128IPR001005SANT/Myb domain
PROSITE profilePS5129421.18484133IPR017930Myb domain
CDDcd001671.22E-1186129No hitNo description
Gene3DG3DSA:1.10.10.607.6E-2386131IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MVVPSSGAGG GVEGGGGGVS APAGSGSGGR VKGSWTPEED DLLRRAVTRH GPRNWTVISA  60
EIPGRSGKSC RLRWCNQLSP GVERRAFTPE EDAVIVAAHA QYGNKWATIA RMLHGRTDNS  120
VKNHWNSTLR RQRRAAAANA NANANAATVG CALQLRPLAA AAVTSAPVPL CHLLDLKESA  180
AAAASVPFHR LDPKEVVEDD EDMDEEDDED GSSEDSVLMP PPKKRPCAGD QHPSSLAVKP  240
EHAKPPPPLP APAPAPAEPL TSLTLSLPGN GVGVHDETPA PHSPAAAASV EAAVSMRAKL  300
EQDPWFVPVM RQMICEEVQR QMQGMDVSCS SLVAVPAAGR SSAGGGADNG GGANDHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-36311323104C-Myb DNA-Binding Domain
1msf_C6e-36311323104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9698541e-150EU969854.1 Zea mays clone 336503 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439611.10.0hypothetical protein SORBIDRAFT_09g016570
TrEMBLC5YWC00.0C5YWC0_SORBI; Putative uncharacterized protein Sb09g016570
STRINGSb09g016570.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-53myb domain protein 73